PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast07G175200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family B3
Protein Properties Length: 398aa    MW: 44109.9 Da    PI: 10.3688
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast07G175200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3352.5e-11191161097
                         HHHTT-EE--HHH.HTT.........---..--SEEEEEETTS-EEEEEE.....EEETTE...EEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3  10 vlksgrlvlpkkfaeeh.........ggkkeesktltledesgrsWevkliy...rkksgr...yvltkGWkeFvkangLkegDfvvFkld 85 
                         ++ ++ l++p +fa+           +++ +e++++ +  + g++W+v l         g+    +l++GW e + a+g+ eg +vv++++
  Brast07G175200.1.p  19 SSCLHKLRVPPEFAAGLdpgagvreeEEDGAEQREVLVVGPLGKVWRVGLLCqqqG---GGgggWWLGSGWAELAAAHGVSEGWSVVLRRE 106
                         455678999****9888999988877444457889***************774433...33456*************************76 PP

                         SSSEE..EEEEE CS
                  B3  86 grsefelvvkvf 97 
                         +r  +  +v +f
  Brast07G175200.1.p 107 RRGVA--TVAAF 116
                         65444..66665 PP

2B346.66e-15141230295
                         EEE-..-HHHHTT-EE--HHH.HTT...---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                  B3   2 fkvltpsdvlksgrlvlpkkfaeeh...ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                         +k l ++d l++  +++p kf++eh    ++ + s+t ++ ++ ++ W+++l  +++++ +++++GW +F  a++L +g ++vF+++g+  
  Brast07G175200.1.p 141 IKLL-QPDDLEK--MRVPDKFVQEHlteTESCPISQTAIILSPLSKFWRLEL--ERGQSDVLFKDGWARFLMAHDLSQGNILVFRYEGNLV 226
                         4444.6777766..79*********98855667999****************..*******************************998766 PP

                         E..EEE CS
                  B3  90 felvvk 95 
                         f   v 
  Brast07G175200.1.p 227 F--SVE 230
                         6..454 PP

3B344.23.4e-14306388286
                         EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         fk+ ++ ++lks  l +  +f++++g++++++++l+    s rsW+v ++ + +  +y+ +  Wk+F+++n+LkegD ++F  ++
  Brast07G175200.1.p 306 FKKQINRYSLKSF-LAVKGTFCSSIGLVSACTIKLQTSMDSTRSWSVPFN-TANTYGYITGPRWKRFCRDNKLKEGDLCTFNIVK 388
                         5777899999998.999***********99977777666888*******4.4444569999********************9655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508638.81110119IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.4E-1212119IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.001112119IPR003340B3 DNA binding domain
SuperFamilySSF1019361.57E-1117121IPR015300DNA-binding pseudobarrel domain
PfamPF023621.4E-822114IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-18136237IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-19137241IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.899137235IPR003340B3 DNA binding domain
CDDcd100174.65E-15138232No hitNo description
SMARTSM010191.2E-9140235IPR003340B3 DNA binding domain
PfamPF023628.9E-12141227IPR003340B3 DNA binding domain
SuperFamilySSF1019361.9E-13302396IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.1E-16302396IPR015300DNA-binding pseudobarrel domain
CDDcd100171.44E-6304384No hitNo description
SMARTSM010190.012306397IPR003340B3 DNA binding domain
PfamPF023621.4E-10307388IPR003340B3 DNA binding domain
PROSITE profilePS5086310.856336397IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MAHSARRLRL KFAAPSLSSS CLHKLRVPPE FAAGLDPGAG VREEEEDGAE QREVLVVGPL  60
GKVWRVGLLC QQQGGGGGGW WLGSGWAELA AAHGVSEGWS VVLRRERRGV ATVAAFDPGR  120
CLARLCTPHA GLIFKNRPRF IKLLQPDDLE KMRVPDKFVQ EHLTETESCP ISQTAIILSP  180
LSKFWRLELE RGQSDVLFKD GWARFLMAHD LSQGNILVFR YEGNLVFSVE VFLQNGCLKE  240
YTRAGSLILT DDPNGPRTGT PQSGKELVVA TASKKRKYRK RVVSPNSANK VGSQCKLANT  300
VRRPSFKKQI NRYSLKSFLA VKGTFCSSIG LVSACTIKLQ TSMDSTRSWS VPFNTANTYG  360
YITGPRWKRF CRDNKLKEGD LCTFNIVKTT VWHVVIN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229793.10.0PREDICTED: putative B3 domain-containing protein Os06g0632500
SwissprotQ67VL71e-139Y6325_ORYSJ; Putative B3 domain-containing protein Os06g0632500
TrEMBLI1GX580.0I1GX58_BRADI; Uncharacterized protein
STRINGBRADI1G35587.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.13e-13B3 family protein